PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA1406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 599aa    MW: 65459.2 Da    PI: 8.2417
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA1406genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461.1e-14141179241
                       TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                               ++k+CnC++s+Clk+YCeCfaag +C+  CkC +C+N+ +
  Tp57577_TGAC_v2_mRNA1406 141 KQKHCNCRNSRCLKLYCECFAAGIYCDG-CKCINCHNNVD 179
                               89**************************.********986 PP

2TCR50.54.1e-16225263139
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                               k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN 
  Tp57577_TGAC_v2_mRNA1406 225 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNF 263
                               589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.0E-18140180IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.165141265IPR005172CRC domain
PfamPF036384.9E-12142177IPR005172CRC domain
SMARTSM011141.5E-17225266IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12228263IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MEKSETTLDL ASRKSVRQLD FTAVYGGPVH LTLSPPTPRS LSQTILQPPT KSRTAAQLQL  60
DFQLLGRRTW LCSPPRWQEQ RTSQSPPVMP RLQSPESQLV SPVRRIQKLP VKRLQALKHE  120
SPSPRSQSQN NAGLKDNTPK KQKHCNCRNS RCLKLYCECF AAGIYCDGCK CINCHNNVDN  180
ETARQEAVGI TLERNPDAFK PKIASSPQKP EVSMEEVSET QVIGKHNKGC HCKKSGCLKK  240
YCECFQANIL CSENCKCMDC KNFEGCDERR TVFQEECPLV QIRQTTNAAI DGAVGPSISG  300
THITPKKRKV QEIFSGKSIV DQTVNTTAQY QQELDPIASS PLSVSASFVS DMANTRTSGS  360
SRSTYRSVLA DVLQTQSVKN LCSLLVVLSG VAANTNAEVR GEVVRKIGPR KYEASIASSA  420
QPLQDSRSVL KPVCENHANK DVTDAVDIDI GNRPPSPETL GLMCDEQDGM FFGNGSANGV  480
AIDNTYLNMI QTSSNSDGCT DAYAEQERLI LTKFRDVLGG LVTLGSIKET RYSSLMKKDV  540
GIKKGPTDNG DRGAETKEIL GNYTTNCSIP AVTEVFEAAC ARTNGHDTID LSLRLPAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462002.10.0tesmin/TSO1-like CXC domain protein
TrEMBLG7ZWG40.0G7ZWG4_MEDTR; Lin-54-like protein
STRINGGLYMA04G08670.20.0(Glycine max)
STRINGGLYMA06G08774.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151511113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-115Tesmin/TSO1-like CXC domain-containing protein